Lineage for d1g5gf1 (1g5g F:33-66,F:224-454)

  1. Root: SCOP 1.59
  2. 141686Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 142442Fold f.12: Head and neck region of the ectodomain of NDV fusion glycoprotein [69921] (1 superfamily)
  4. 142443Superfamily f.12.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69922] (1 family) (S)
  5. 142444Family f.12.1.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69923] (1 protein)
  6. 142445Protein Head and neck region of the ectodomain of NDV fusion glycoprotein [69924] (1 species)
  7. 142446Species Newcastle disease virus [TaxId:11176] [69925] (1 PDB entry)
  8. 142452Domain d1g5gf1: 1g5g F:33-66,F:224-454 [65165]
    Other proteins in same PDB: d1g5ga2, d1g5gb2, d1g5gc2, d1g5gd2, d1g5ge2, d1g5gf2

Details for d1g5gf1

PDB Entry: 1g5g (more details), 3.3 Å

PDB Description: fragment of fusion protein from newcastle disease virus

SCOP Domain Sequences for d1g5gf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5gf1 f.12.1.1 (F:33-66,F:224-454) Head and neck region of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus}
dgrplaaagivvtgdkavniytssqtgsiiikllXqitspaltqltiqalynlaggnmdy
lltklgvgnnqlsslissglitgnpilydsqtqllgiqvtlpsvgnlnnmratyletlsv
sttkgfasalvpkvvtqvgsvieeldtsycietdldlyctrivtfpmspgiysclsgnts
acmysktegalttpymtlkgsvianckmttcrcadppgiisqnygeavslidrqscnils
ldgitlrlsgefdatyqknisiqdsq

SCOP Domain Coordinates for d1g5gf1:

Click to download the PDB-style file with coordinates for d1g5gf1.
(The format of our PDB-style files is described here.)

Timeline for d1g5gf1: