SCOP 1.59: Domain d1g5gd1: 1g5g D:33-66,D:224-454

Lineage for d1g5gd1 (1g5g D:33-66,D:224-454)

1. Root: SCOP 1.59

2. Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)

3. Fold f.12: Head and neck region of the ectodomain of NDV fusion glycoprotein [69921] (1 superfamily)

4. Superfamily f.12.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69922] (1 family)

5. Family f.12.1.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69923] (1 protein)

6. Protein Head and neck region of the ectodomain of NDV fusion glycoprotein [69924] (1 species)

7. Species Newcastle disease virus [TaxId:11176] [69925] (1 PDB entry)

8. Domain d1g5gd1: 1g5g D:33-66,D:224-454 [65161]
   Other proteins in same PDB: d1g5ga2, d1g5gb2, d1g5gc2, d1g5gd2, d1g5ge2, d1g5gf2

Details for d1g5gd1

PDB Entry: 1g5g, 3.3 Å

PDB Description: fragment of fusion protein from newcastle disease virus

SCOP Domain Sequences for d1g5gd1:

Sequence; same for both SEQRES and ATOM records:

>d1g5gd1 f.12.1.1 (D:33-66,D:224-454) Head and neck region of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus}
dgrplaaagivvtgdkavniytssqtgsiiikllXqitspaltqltiqalynlaggnmdy
lltklgvgnnqlsslissglitgnpilydsqtqllgiqvtlpsvgnlnnmratyletlsv
sttkgfasalvpkvvtqvgsvieeldtsycietdldlyctrivtfpmspgiysclsgnts
acmysktegalttpymtlkgsvianckmttcrcadppgiisqnygeavslidrqscnils
ldgitlrlsgefdatyqknisiqdsq

Timeline for d1g5gd1:

• d1g5gd1 is new in SCOP 1.59
  
• d1g5gd1 appears in SCOP 1.61
  
• d1g5gd1 appears in the current release, SCOPe 2.08