SCOPe 2.08: Domain d1g5gb1: 1g5g B:33-66,B:224-454

Lineage for d1g5gb1 (1g5g B:33-66,B:224-454)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.12: Head and neck region of the ectodomain of NDV fusion glycoprotein [69921] (1 superfamily)
   3 intertwined all-beta domains

4. Superfamily f.12.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69922] (1 family)

5. Family f.12.1.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69923] (1 protein)

6. Protein Head and neck region of the ectodomain of NDV fusion glycoprotein [69924] (1 species)

7. Species Newcastle disease virus [TaxId:11176] [69925] (1 PDB entry)

8. Domain d1g5gb1: 1g5g B:33-66,B:224-454 [65157]
   Other proteins in same PDB: d1g5ga2, d1g5gb2, d1g5gc2, d1g5gd2, d1g5ge2, d1g5gf2
   complexed with nag

Details for d1g5gb1

PDB Entry: 1g5g, 3.3 Å

PDB Description: fragment of fusion protein from newcastle disease virus

PDB Compounds: (B:) Fusion protein

SCOPe Domain Sequences for d1g5gb1:

Sequence; same for both SEQRES and ATOM records:

>d1g5gb1 f.12.1.1 (B:33-66,B:224-454) Head and neck region of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus [TaxId: 11176]}
dgrplaaagivvtgdkavniytssqtgsiiikllXqitspaltqltiqalynlaggnmdy
lltklgvgnnqlsslissglitgnpilydsqtqllgiqvtlpsvgnlnnmratyletlsv
sttkgfasalvpkvvtqvgsvieeldtsycietdldlyctrivtfpmspgiysclsgnts
acmysktegalttpymtlkgsvianckmttcrcadppgiisqnygeavslidrqscnils
ldgitlrlsgefdatyqknisiqdsq

Timeline for d1g5gb1:

• d1g5gb1 first appeared in SCOP 1.59
  
• d1g5gb1 appears in SCOPe 2.07