SCOP 1.63: Domain d1g5ga1: 1g5g A:33-66,A:224-454

Lineage for d1g5ga1 (1g5g A:33-66,A:224-454)

Root: SCOP 1.63
Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
Fold f.12: Head and neck region of the ectodomain of NDV fusion glycoprotein [69921] (1 superfamily)
3 intertwined all-beta domains
Superfamily f.12.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69922] (1 family)
Family f.12.1.1: Head and neck region of the ectodomain of NDV fusion glycoprotein [69923] (1 protein)
Protein Head and neck region of the ectodomain of NDV fusion glycoprotein [69924] (1 species)
Species Newcastle disease virus [TaxId:11176] [69925] (1 PDB entry)
Domain d1g5ga1: 1g5g A:33-66,A:224-454 [65155]
Other proteins in same PDB: d1g5ga2, d1g5gb2, d1g5gc2, d1g5gd2, d1g5ge2, d1g5gf2

Details for d1g5ga1

PDB Entry: 1g5g (more details), 3.3 Å

PDB Description: fragment of fusion protein from newcastle disease virus

SCOP Domain Sequences for d1g5ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5ga1 f.12.1.1 (A:33-66,A:224-454) Head and neck region of the ectodomain of NDV fusion glycoprotein {Newcastle disease virus}
dgrplaaagivvtgdkavniytssqtgsiiikllXqitspaltqltiqalynlaggnmdy
lltklgvgnnqlsslissglitgnpilydsqtqllgiqvtlpsvgnlnnmratyletlsv
sttkgfasalvpkvvtqvgsvieeldtsycietdldlyctrivtfpmspgiysclsgnts
acmysktegalttpymtlkgsvianckmttcrcadppgiisqnygeavslidrqscnils
ldgitlrlsgefdatyqknisiqdsq

SCOP Domain Coordinates for d1g5ga1:

Click to download the PDB-style file with coordinates for d1g5ga1.
(The format of our PDB-style files is described here.)

Timeline for d1g5ga1: