Lineage for d1g5aa2 (1g5a A:1-554)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081525Protein Amylosucrase [69384] (1 species)
  7. 2081526Species Neisseria polysaccharea [TaxId:489] [69385] (10 PDB entries)
  8. 2081527Domain d1g5aa2: 1g5a A:1-554 [65153]
    Other proteins in same PDB: d1g5aa1
    complexed with epe, na, trs

Details for d1g5aa2

PDB Entry: 1g5a (more details), 1.4 Å

PDB Description: amylosucrase from neisseria polysaccharea
PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d1g5aa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]}
spnsqylktrildiytpeqragieksedwrqfsrrmdthfpklmneldsvygnneallpm
lemllaqawqsysqrnsslkdidiarennpdwilsnkqvggvcyvdlfagdlkglkdkip
yfqelgltylhlmplfkcpegksdggyavssyrdvnpalgtigdlreviaalheagisav
vdfifnhtsnehewaqrcaagdplfdnfyyifpdrrmpdqydrtlreifpdqhpggfsql
edgrwvwttfnsfqwdlnysnpwvframagemlflanlgvdilrmdavafiwkqmgtsce
nlpqahalirafnavmriaapavffkseaivhpdqvvqyigqdecqigynplqmallwnt
latrevnllhqaltyrhnlpehtawvnyvrshddigwtfadedaaylgisgydhrqflnr
ffvnrfdgsfargvpfqynpstgdcrvsgtaaalvglaqddphavdrikllysialstgg
lpliylgdevgtlndddwsqdsnksddsrwahrprynealyaqrndpstaagqiyqdlrh
miavrqsnprfdgg

SCOPe Domain Coordinates for d1g5aa2:

Click to download the PDB-style file with coordinates for d1g5aa2.
(The format of our PDB-style files is described here.)

Timeline for d1g5aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g5aa1