![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Amylosucrase [69328] (1 species) |
![]() | Species Neisseria polysaccharea [TaxId:489] [69329] (10 PDB entries) |
![]() | Domain d1g5aa1: 1g5a A:555-628 [65152] Other proteins in same PDB: d1g5aa2 complexed with epe, na, trs |
PDB Entry: 1g5a (more details), 1.4 Å
SCOPe Domain Sequences for d1g5aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g5aa1 b.71.1.1 (A:555-628) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd ltlqpyqvmwleia
Timeline for d1g5aa1: