Lineage for d1g50c_ (1g50 C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747177Protein Estrogen receptor alpha [48519] (1 species)
  7. 1747178Species Human (Homo sapiens) [TaxId:9606] [48520] (61 PDB entries)
    Uniprot P03372 307-551
  8. 1747300Domain d1g50c_: 1g50 C: [65151]
    complexed with est

Details for d1g50c_

PDB Entry: 1g50 (more details), 2.9 Å

PDB Description: crystal structure of a wild type her alpha lbd at 2.9 angstrom resolution
PDB Compounds: (C:) Estrogen receptor

SCOPe Domain Sequences for d1g50c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g50c_ a.123.1.1 (C:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllem
ldah

SCOPe Domain Coordinates for d1g50c_:

Click to download the PDB-style file with coordinates for d1g50c_.
(The format of our PDB-style files is described here.)

Timeline for d1g50c_: