Lineage for d1g4ra2 (1g4r A:176-393)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937486Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 938102Family b.1.18.11: Arrestin/Vps26-like [81291] (1 protein)
  6. 938103Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 938104Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (4 PDB entries)
  8. 938110Domain d1g4ra2: 1g4r A:176-393 [65148]

Details for d1g4ra2

PDB Entry: 1g4r (more details), 2.2 Å

PDB Description: crystal structure of bovine beta-arrestin 1
PDB Compounds: (A:) beta-arrestin 1

SCOPe Domain Sequences for d1g4ra2:

Sequence, based on SEQRES records: (download)

>d1g4ra2 b.1.18.11 (A:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsrggllgdlassdvavelpftlmhpk
pkeepphrevpehetpvdtnlieldtndddivfedfar

Sequence, based on observed residues (ATOM records): (download)

>d1g4ra2 b.1.18.11 (A:176-393) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
erpgpqptaettrqflmsdkplhleasldkeiyyhgepisvnvhvtnntnktvkkikisv
rqyadiclfntaqykcpvameeaddtvapsstfckvytltpflannrekrglaldgklkh
edtnlasstllreganreilgiivsykvkvklvvsdlassdvavelpftlmhpkpdivfe
dfar

SCOPe Domain Coordinates for d1g4ra2:

Click to download the PDB-style file with coordinates for d1g4ra2.
(The format of our PDB-style files is described here.)

Timeline for d1g4ra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4ra1