Lineage for d1g4ra1 (1g4r A:7-175)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 223262Superfamily b.1.18: E set domains [81296] (17 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 223557Family b.1.18.11: Arrestin [81291] (1 protein)
  6. 223558Protein Arrestin [49244] (2 species)
    duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head
  7. 223559Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (3 PDB entries)
  8. 223564Domain d1g4ra1: 1g4r A:7-175 [65147]

Details for d1g4ra1

PDB Entry: 1g4r (more details), 2.2 Å

PDB Description: crystal structure of bovine beta-arrestin 1

SCOP Domain Sequences for d1g4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4ra1 b.1.18.11 (A:7-175) Arrestin {Cow (Bos taurus), beta-arrestin 1}
rvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygre
dldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpcs
vtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOP Domain Coordinates for d1g4ra1:

Click to download the PDB-style file with coordinates for d1g4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1g4ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4ra2