Lineage for d1g4ra1 (1g4r A:7-175)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104969Family b.1.1.5: E set domains [49208] (25 proteins)
  6. 104970Protein Arrestin [49244] (2 species)
  7. 104971Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (2 PDB entries)
  8. 104976Domain d1g4ra1: 1g4r A:7-175 [65147]

Details for d1g4ra1

PDB Entry: 1g4r (more details), 2.2 Å

PDB Description: crystal structure of bovine beta-arrestin 1

SCOP Domain Sequences for d1g4ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4ra1 b.1.1.5 (A:7-175) Arrestin {Cow (Bos taurus), beta-arrestin 1}
rvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygre
dldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpcs
vtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOP Domain Coordinates for d1g4ra1:

Click to download the PDB-style file with coordinates for d1g4ra1.
(The format of our PDB-style files is described here.)

Timeline for d1g4ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4ra2