![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
![]() | Protein Arrestin [49244] (3 species) duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head |
![]() | Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries) |
![]() | Domain d1g4mb1: 1g4m B:5-175 [65145] |
PDB Entry: 1g4m (more details), 1.9 Å
SCOPe Domain Sequences for d1g4mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4mb1 b.1.18.11 (B:5-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]} gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
Timeline for d1g4mb1: