Lineage for d1g4mb1 (1g4m B:5-175)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 160629Family b.1.1.5: E set domains [49208] (27 proteins)
  6. 160630Protein Arrestin [49244] (2 species)
  7. 160631Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (3 PDB entries)
  8. 160634Domain d1g4mb1: 1g4m B:5-175 [65145]

Details for d1g4mb1

PDB Entry: 1g4m (more details), 1.9 Å

PDB Description: crystal structure of bovine beta-arrestin 1

SCOP Domain Sequences for d1g4mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4mb1 b.1.1.5 (B:5-175) Arrestin {Cow (Bos taurus), beta-arrestin 1}
gtrvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafryg
redldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlp
csvtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap

SCOP Domain Coordinates for d1g4mb1:

Click to download the PDB-style file with coordinates for d1g4mb1.
(The format of our PDB-style files is described here.)

Timeline for d1g4mb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g4mb2