Lineage for d1g4ha_ (1g4h A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151248Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2151249Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2151256Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)
  8. 2151266Domain d1g4ha_: 1g4h A: [65142]
    complexed with 1bo, ca, cl

Details for d1g4ha_

PDB Entry: 1g4h (more details), 1.8 Å

PDB Description: linb complexed with butan-1-ol
PDB Compounds: (A:) 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase

SCOPe Domain Sequences for d1g4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g4ha_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
lgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacd
ligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhr
ervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpl
seaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfin
aepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

SCOPe Domain Coordinates for d1g4ha_:

Click to download the PDB-style file with coordinates for d1g4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1g4ha_: