Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
Protein Haloalkane dehalogenase [53514] (4 species) |
Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries) |
Domain d1g4ha_: 1g4h A: [65142] complexed with 1bo, ca, cl |
PDB Entry: 1g4h (more details), 1.8 Å
SCOPe Domain Sequences for d1g4ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g4ha_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} lgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacd ligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhr ervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpl seaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfin aepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa
Timeline for d1g4ha_: