![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) ![]() the N-terminal domains of these repressors bind DNA |
![]() | Family b.34.1.2: FeoA-like [50041] (5 proteins) |
![]() | Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries) Uniprot P33120 |
![]() | Domain d1g3ya3: 1g3y A:148-225 [65138] Other proteins in same PDB: d1g3ya1, d1g3ya2 complexed with zn |
PDB Entry: 1g3y (more details), 2.8 Å
SCOPe Domain Sequences for d1g3ya3:
Sequence, based on SEQRES records: (download)
>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn gkdvellddlahtiriee
>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaamprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv ellddlahtiriee
Timeline for d1g3ya3: