SCOP 1.69: Domain d1g3ya3: 1g3y A:148-225

Lineage for d1g3ya3 (1g3y A:148-225)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.34: SH3-like barrel [50036] (15 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (13 PDB entries)

8. Domain d1g3ya3: 1g3y A:148-225 [65138]
   Other proteins in same PDB: d1g3ya1, d1g3ya2

Details for d1g3ya3

PDB Entry: 1g3y, 2.8 Å

PDB Description: arg80ala dtxr

SCOP Domain Sequences for d1g3ya3:

Sequence, based on SEQRES records:

>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtiriee

Sequence, based on observed residues (ATOM records):

>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaamprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv
ellddlahtiriee

Timeline for d1g3ya3:

• d1g3ya3 first appeared in SCOP 1.59
  
• d1g3ya3 appears in SCOP 1.67
  
• d1g3ya3 appears in SCOP 1.71
  
• d1g3ya3 appears in the current release, SCOPe 2.08