| Class b: All beta proteins [48724] (144 folds) |
| Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) ![]() the N-terminal domains of these repressors bind DNA |
| Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins) |
| Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
| Species Corynebacterium diphtheriae [TaxId:1717] [50043] (13 PDB entries) |
| Domain d1g3ya3: 1g3y A:148-225 [65138] Other proteins in same PDB: d1g3ya1, d1g3ya2 |
PDB Entry: 1g3y (more details), 2.8 Å
SCOP Domain Sequences for d1g3ya3:
Sequence, based on SEQRES records: (download)
>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtiriee
>d1g3ya3 b.34.1.2 (A:148-225) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaamprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngkdv
ellddlahtiriee
Timeline for d1g3ya3: