SCOPe 2.07: Domain d1g3ya1: 1g3y A:3-64

Lineage for d1g3ya1 (1g3y A:3-64)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d1g3ya1: 1g3y A:3-64 [65136]
   Other proteins in same PDB: d1g3ya2, d1g3ya3
   complexed with zn

Details for d1g3ya1

PDB Entry: 1g3y, 2.8 Å

PDB Description: arg80ala dtxr

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3ya1:

Sequence; same for both SEQRES and ATOM records:

>d1g3ya1 a.4.5.24 (A:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl
qm

Timeline for d1g3ya1:

• d1g3ya1 first appeared in SCOP 1.59
  
• d1g3ya1 appears in SCOPe 2.06
  
• d1g3ya1 appears in the current release, SCOPe 2.08