![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins) automatically mapped to Pfam PF01325 |
![]() | Protein Diphtheria toxin repressor (DtxR) [46883] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [46884] (17 PDB entries) Uniprot P33120 |
![]() | Domain d1g3ya1: 1g3y A:3-64 [65136] Other proteins in same PDB: d1g3ya2, d1g3ya3 complexed with zn |
PDB Entry: 1g3y (more details), 2.8 Å
SCOPe Domain Sequences for d1g3ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g3ya1 a.4.5.24 (A:3-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} dlvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrsl qm
Timeline for d1g3ya1: