Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: FeoA-like [50041] (5 proteins) |
Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries) Uniprot P33120 |
Domain d1g3wa3: 1g3w A:148-224 [65135] Other proteins in same PDB: d1g3wa1, d1g3wa2 complexed with cd, so4 |
PDB Entry: 1g3w (more details), 2.4 Å
SCOPe Domain Sequences for d1g3wa3:
Sequence, based on SEQRES records: (download)
>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn gkdvellddlahtirie
>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdhitlshngkd vellddlahtirie
Timeline for d1g3wa3: