SCOPe 2.06: Domain d1g3wa3: 1g3w A:148-224

Lineage for d1g3wa3 (1g3w A:148-224)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families)
   the N-terminal domains of these repressors bind DNA

5. Family b.34.1.2: FeoA-like [50041] (5 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
   Uniprot P33120

8. Domain d1g3wa3: 1g3w A:148-224 [65135]
   Other proteins in same PDB: d1g3wa1, d1g3wa2
   complexed with cd, so4

Details for d1g3wa3

PDB Entry: 1g3w, 2.4 Å

PDB Description: cd-cys102ser dtxr

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3wa3:

Sequence, based on SEQRES records:

>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirie

Sequence, based on observed residues (ATOM records):

>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdhitlshngkd
vellddlahtirie

Timeline for d1g3wa3:

• d1g3wa3 first appeared in SCOP 1.59
  
• d1g3wa3 appears in SCOPe 2.05
  
• d1g3wa3 appears in SCOPe 2.07
  
• d1g3wa3 appears in the current release, SCOPe 2.08