Lineage for d1g3wa3 (1g3w A:148-224)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109315Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) (S)
  5. 109323Family b.34.1.2: Iron-dependent regulator [50041] (2 proteins)
  6. 109324Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 109325Species Corynebacterium diphtheriae [TaxId:1717] [50043] (12 PDB entries)
  8. 109327Domain d1g3wa3: 1g3w A:148-224 [65135]
    Other proteins in same PDB: d1g3wa1, d1g3wa2

Details for d1g3wa3

PDB Entry: 1g3w (more details), 2.4 Å

PDB Description: cd-cys102ser dtxr

SCOP Domain Sequences for d1g3wa3:

Sequence, based on SEQRES records: (download)

>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirie

Sequence, based on observed residues (ATOM records): (download)

>d1g3wa3 b.34.1.2 (A:148-224) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdhitlshngkd
vellddlahtirie

SCOP Domain Coordinates for d1g3wa3:

Click to download the PDB-style file with coordinates for d1g3wa3.
(The format of our PDB-style files is described here.)

Timeline for d1g3wa3: