Lineage for d1g3wa2 (1g3w A:65-140)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540561Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 540562Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) (S)
  5. 540563Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins)
  6. 540564Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 540565Species Corynebacterium diphtheriae [TaxId:1717] [47982] (16 PDB entries)
  8. 540567Domain d1g3wa2: 1g3w A:65-140 [65134]
    Other proteins in same PDB: d1g3wa1, d1g3wa3
    complexed with cd, so4; mutant

Details for d1g3wa2

PDB Entry: 1g3w (more details), 2.4 Å

PDB Description: cd-cys102ser dtxr

SCOP Domain Sequences for d1g3wa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3wa2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOP Domain Coordinates for d1g3wa2:

Click to download the PDB-style file with coordinates for d1g3wa2.
(The format of our PDB-style files is described here.)

Timeline for d1g3wa2: