Lineage for d1g3ua_ (1g3u A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829352Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (20 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 829678Protein Thymidylate kinase [52563] (4 species)
  7. 829716Species Mycobacterium tuberculosis [TaxId:1773] [69482] (11 PDB entries)
  8. 829722Domain d1g3ua_: 1g3u A: [65132]
    complexed with mg, sul, tmp

Details for d1g3ua_

PDB Entry: 1g3u (more details), 1.95 Å

PDB Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine monophosphate (tmp)
PDB Compounds: (A:) thymidylate kinase

SCOP Domain Sequences for d1g3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ua_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}
mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
elaaqgwggrwlvvgadvdpgrlaatla

SCOP Domain Coordinates for d1g3ua_:

Click to download the PDB-style file with coordinates for d1g3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1g3ua_: