SCOP 1.59: Domain d1g3tb2: 1g3t B:1065-1140

Lineage for d1g3tb2 (1g3t B:1065-1140)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.76: Iron-dependent represor protein, dimerization domain [47978] (1 superfamily)

4. Superfamily a.76.1: Iron-dependent represor protein, dimerization domain [47979] (1 family)

5. Family a.76.1.1: Iron-dependent represor protein, dimerization domain [47980] (2 proteins)

6. Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [47982] (15 PDB entries)

8. Domain d1g3tb2: 1g3t B:1065-1140 [65131]
   Other proteins in same PDB: d1g3ta1, d1g3ta3, d1g3tb1

Details for d1g3tb2

PDB Entry: 1g3t, 2.35 Å

PDB Description: cys102ser dtxr

SCOP Domain Sequences for d1g3tb2:

Sequence; same for both SEQRES and ATOM records:

>d1g3tb2 a.76.1.1 (B:1065-1140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

Timeline for d1g3tb2:

• d1g3tb2 is new in SCOP 1.59
  
• d1g3tb2 appears in SCOP 1.61
  
• d1g3tb2 appears in the current release, SCOPe 2.08