Lineage for d1g3ta3 (1g3t A:148-226)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392351Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (4 families) (S)
    the N-terminal domains of these repressors bind DNA
  5. 2392417Family b.34.1.2: FeoA-like [50041] (5 proteins)
  6. 2392418Protein Diphtheria toxin repressor (DtxR) [50042] (1 species)
  7. 2392419Species Corynebacterium diphtheriae [TaxId:1717] [50043] (18 PDB entries)
    Uniprot P33120
  8. 2392430Domain d1g3ta3: 1g3t A:148-226 [65129]
    Other proteins in same PDB: d1g3ta1, d1g3ta2, d1g3tb1, d1g3tb2

Details for d1g3ta3

PDB Entry: 1g3t (more details), 2.35 Å

PDB Description: cys102ser dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3ta3:

Sequence, based on SEQRES records: (download)

>d1g3ta3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn
gkdvellddlahtirieel

Sequence, based on observed residues (ATOM records): (download)

>d1g3ta3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk
dvellddlahtirieel

SCOPe Domain Coordinates for d1g3ta3:

Click to download the PDB-style file with coordinates for d1g3ta3.
(The format of our PDB-style files is described here.)

Timeline for d1g3ta3: