Lineage for d1g3ta2 (1g3t A:65-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331932Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2331933Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) (S)
    automatically mapped to Pfam PF02742
  5. 2331934Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)
  6. 2331935Protein Diphtheria toxin repressor (DtxR) [47981] (1 species)
  7. 2331936Species Corynebacterium diphtheriae [TaxId:1717] [47982] (20 PDB entries)
    Uniprot P33120
  8. 2331951Domain d1g3ta2: 1g3t A:65-140 [65128]
    Other proteins in same PDB: d1g3ta1, d1g3ta3, d1g3tb1

Details for d1g3ta2

PDB Entry: 1g3t (more details), 2.35 Å

PDB Description: cys102ser dtxr
PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g3ta2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
tptgrtlatavmrkhrlaerlltdiigldinkvhdeasrwehvmsdeverrlvkvlkdvs
rspfgnpipgldelgv

SCOPe Domain Coordinates for d1g3ta2:

Click to download the PDB-style file with coordinates for d1g3ta2.
(The format of our PDB-style files is described here.)

Timeline for d1g3ta2: