SCOPe 2.05: Domain d1g3sa1: 1g3s A:4-64

Lineage for d1g3sa1 (1g3s A:4-64)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Diphtheria toxin repressor (DtxR) [46883] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [46884] (20 PDB entries)
   Uniprot P33120

8. Domain d1g3sa1: 1g3s A:4-64 [65124]
   Other proteins in same PDB: d1g3sa2, d1g3sa3

Details for d1g3sa1

PDB Entry: 1g3s, 2.4 Å

PDB Description: cys102ser dtxr

PDB Compounds: (A:) diphtheria toxin repressor

SCOPe Domain Sequences for d1g3sa1:

Sequence; same for both SEQRES and ATOM records:

>d1g3sa1 a.4.5.24 (A:4-64) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]}
lvdttemylrtiyeleeegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
m

Timeline for d1g3sa1:

• d1g3sa1 first appeared in SCOP 1.59
  
• d1g3sa1 appears in SCOPe 2.04
  
• d1g3sa1 appears in SCOPe 2.06
  
• d1g3sa1 appears in the current release, SCOPe 2.08