Lineage for d1g2qb_ (1g2q B:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 125303Fold c.61: PRTase-like [53270] (1 superfamily)
  4. 125304Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 125305Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (9 proteins)
  6. 125306Protein Adenine PRTase [53288] (2 species)
  7. 125307Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69541] (2 PDB entries)
  8. 125309Domain d1g2qb_: 1g2q B: [65118]

Details for d1g2qb_

PDB Entry: 1g2q (more details), 1.5 Å

PDB Description: crystal structure of adenine phosphoribosyltransferase

SCOP Domain Sequences for d1g2qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g2qb_ c.61.1.1 (B:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae)}
mpiasyaqelklalhqypnfpsegilfedflpifrnpglfqklidafklhleeafpevki
dyivglesrgflfgptlalalgvgfvpvrkagklpgecfkatyekeygsdlfeiqknaip
agsnviivddiiatggsaaaagelveqleanlleynfvmeldflkgrsklnapvftll

SCOP Domain Coordinates for d1g2qb_:

Click to download the PDB-style file with coordinates for d1g2qb_.
(The format of our PDB-style files is described here.)

Timeline for d1g2qb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g2qa_