| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
| Family d.167.1.1: Peptide deformylase [56421] (2 proteins) automatically mapped to Pfam PF01327 |
| Protein Peptide deformylase [56422] (11 species) |
| Species Escherichia coli [TaxId:562] [56423] (21 PDB entries) |
| Domain d1g2ac_: 1g2a C: [65111] complexed with bb2, ni |
PDB Entry: 1g2a (more details), 1.75 Å
SCOPe Domain Sequences for d1g2ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g2ac_ d.167.1.1 (C:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl
Timeline for d1g2ac_: