SCOP 1.59: Domain d1g2aa_: 1g2a A:

Lineage for d1g2aa_ (1g2a A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)

4. Superfamily d.167.1: Peptide deformylase [56420] (1 family)

5. Family d.167.1.1: Peptide deformylase [56421] (1 protein)

6. Protein Peptide deformylase [56422] (1 species)

7. Species Escherichia coli [TaxId:562] [56423] (14 PDB entries)

8. Domain d1g2aa_: 1g2a A: [65109]

Details for d1g2aa_

PDB Entry: 1g2a, 1.75 Å

PDB Description: the crystal structure of e.coli peptide deformylase complexed with actinonin

SCOP Domain Sequences for d1g2aa_:

Sequence; same for both SEQRES and ATOM records:

>d1g2aa_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

Timeline for d1g2aa_:

• d1g2aa_ is new in SCOP 1.59
  
• d1g2aa_ appears in SCOP 1.61
  
• d1g2aa_ appears in the current release, SCOPe 2.08