Lineage for d1g27a_ (1g27 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2606866Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2606867Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2606868Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 2606869Protein Peptide deformylase [56422] (11 species)
  7. 2606875Species Escherichia coli [TaxId:562] [56423] (21 PDB entries)
  8. 2606912Domain d1g27a_: 1g27 A: [65106]
    complexed with bb1, ni

Details for d1g27a_

PDB Entry: 1g27 (more details), 2.1 Å

PDB Description: crystal structure of e.coli polypeptide deformylase complexed with the inhibitor bb-3497
PDB Compounds: (A:) polypeptide deformylase

SCOPe Domain Sequences for d1g27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g27a_ d.167.1.1 (A:) Peptide deformylase {Escherichia coli [TaxId: 562]}
svlqvlhipderlrkvakpveevnaeiqrivddmfetmyaeegiglaatqvdihqriivi
dvsenrderlvlinpelleksgetgieegclsipeqralvpraekvkiraldrdgkpfel
eadgllaiciqhemdhlvgklfmdylsplkqqrirqkvekldrl

SCOPe Domain Coordinates for d1g27a_:

Click to download the PDB-style file with coordinates for d1g27a_.
(The format of our PDB-style files is described here.)

Timeline for d1g27a_: