Lineage for d1g1rc1 (1g1r C:1-118)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878002Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 878003Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 878004Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 878264Protein P-selectin, C-lectin domain [116731] (1 species)
    followed by EGF-like module
  7. 878265Species Human (Homo sapiens) [TaxId:9606] [116732] (3 PDB entries)
  8. 878274Domain d1g1rc1: 1g1r C:1-118 [65096]
    Other proteins in same PDB: d1g1ra2, d1g1rb2, d1g1rc2, d1g1rd2

Details for d1g1rc1

PDB Entry: 1g1r (more details), 3.4 Å

PDB Description: crystal structure of p-selectin lectin/egf domains complexed with slex
PDB Compounds: (C:) p-selectin

SCOP Domain Sequences for d1g1rc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1rc1 d.169.1.1 (C:1-118) P-selectin, C-lectin domain {Human (Homo sapiens) [TaxId: 9606]}
wtyhystkayswnisrkycqnrytdlvaiqnkneidylnkvlpyyssyywigirknnktw
twvgtkkaltneaenwadnepnnkrnnedcveiyikspsapgkwndehclkkkhalcy

SCOP Domain Coordinates for d1g1rc1:

Click to download the PDB-style file with coordinates for d1g1rc1.
(The format of our PDB-style files is described here.)

Timeline for d1g1rc1: