SCOPe 2.06: Domain d1g1qc2: 1g1q C:119-158

Lineage for d1g1qc2 (1g1q C:119-158)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein E-selectin, EGF-domain [57203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries)

8. Domain d1g1qc2: 1g1q C:119-158 [65089]
   Other proteins in same PDB: d1g1qa1, d1g1qa3, d1g1qb1, d1g1qb3, d1g1qc1, d1g1qc3, d1g1qd1, d1g1qd3
   complexed with ca, mrd

Details for d1g1qc2

PDB Entry: 1g1q, 2.4 Å

PDB Description: Crystal structure of P-selectin lectin/EGF domains

PDB Compounds: (C:) p-selectin

SCOPe Domain Sequences for d1g1qc2:

Sequence; same for both SEQRES and ATOM records:

>d1g1qc2 g.3.11.1 (C:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrd

Timeline for d1g1qc2:

• d1g1qc2 first appeared in SCOP 1.59
  
• d1g1qc2 appears in SCOPe 2.05
  
• d1g1qc2 appears in SCOPe 2.07
  
• d1g1qc2 appears in the current release, SCOPe 2.08