| Class g: Small proteins [56992] (91 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein E-selectin, EGF-domain [57203] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57204] (5 PDB entries) |
| Domain d1g1qa2: 1g1q A:119-160 [65085] Other proteins in same PDB: d1g1qa1, d1g1qb1, d1g1qc1, d1g1qd1 complexed with ca, mrd |
PDB Entry: 1g1q (more details), 2.4 Å
SCOPe Domain Sequences for d1g1qa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1qa2 g.3.11.1 (A:119-160) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]}
tascqdmscskqgecletignytcscypgfygpeceyvrddd
Timeline for d1g1qa2: