Lineage for d1g1ob_ (1g1o B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457207Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 457208Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 457209Protein Transthyretin (synonym: prealbumin) [49474] (4 species)
    sandwich; 8 strands in 2 sheets
  7. 457230Species Human (Homo sapiens) [TaxId:9606] [49475] (48 PDB entries)
  8. 457318Domain d1g1ob_: 1g1o B: [65081]

Details for d1g1ob_

PDB Entry: 1g1o (more details), 2.3 Å

PDB Description: crystal structure of the highly amyloidogenic transthyretin mutant ttr g53s/e54d/l55s

SCOP Domain Sequences for d1g1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ob_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsessdshgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOP Domain Coordinates for d1g1ob_:

Click to download the PDB-style file with coordinates for d1g1ob_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ob_: