Lineage for d1g1ca_ (1g1c A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104942Protein Titin [49172] (1 species)
  7. 104943Species Human (Homo sapiens), different modules [TaxId:9606] [49173] (5 PDB entries)
  8. 104944Domain d1g1ca_: 1g1c A: [65078]

Details for d1g1ca_

PDB Entry: 1g1c (more details), 2.1 Å

PDB Description: i1 domain from titin

SCOP Domain Sequences for d1g1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules}
smeapkiferiqsqtvgqgsdahfrvrvvgkpdpecewykngvkiersdriywywpednv
celvirdvtgedsasimvkainiagetsshafllvqak

SCOP Domain Coordinates for d1g1ca_:

Click to download the PDB-style file with coordinates for d1g1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1g1cb_