Lineage for d1fymb_ (1fym B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94900Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (10 superfamilies)
  4. 95173Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (32 families) (S)
  5. 95390Family a.4.5.22: Heat-shock transcription factor [46873] (1 protein)
  6. 95391Protein Heat-shock transcription factor [46874] (2 species)
  7. 95395Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 95407Domain d1fymb_: 1fym B: [65071]

Details for d1fymb_

PDB Entry: 1fym (more details), 2.2 Å

PDB Description: serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a tail- to-tail orientation

SCOP Domain Sequences for d1fymb_:

Sequence, based on SEQRES records: (download)

>d1fymb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefen

Sequence, based on observed residues (ATOM records): (download)

>d1fymb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis)}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqddsrwefen

SCOP Domain Coordinates for d1fymb_:

Click to download the PDB-style file with coordinates for d1fymb_.
(The format of our PDB-style files is described here.)

Timeline for d1fymb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fyma_