Lineage for d1fymb_ (1fym B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305606Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2306133Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 2306134Protein Heat-shock transcription factor [46874] (2 species)
  7. 2306138Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 2306146Domain d1fymb_: 1fym B: [65071]
    protein/DNA complex

Details for d1fymb_

PDB Entry: 1fym (more details), 2.2 Å

PDB Description: serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a tail-to-tail orientation
PDB Compounds: (B:) heat shock transcription protein

SCOPe Domain Sequences for d1fymb_:

Sequence, based on SEQRES records: (download)

>d1fymb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqdvksgsmlsnndsrwefen

Sequence, based on observed residues (ATOM records): (download)

>d1fymb_ a.4.5.22 (B:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
nmygwhkvqddsrwefen

SCOPe Domain Coordinates for d1fymb_:

Click to download the PDB-style file with coordinates for d1fymb_.
(The format of our PDB-style files is described here.)

Timeline for d1fymb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fyma_