SCOPe 2.06: Domain d1fyla_: 1fyl A:

Lineage for d1fyla_ (1fyl A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.22: Heat-shock transcription factor [46873] (2 proteins)
   automatically mapped to Pfam PF00447

6. Protein Heat-shock transcription factor [46874] (2 species)

7. Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)

8. Domain d1fyla_: 1fyl A: [65068]
   protein/DNA complex

Details for d1fyla_

PDB Entry: 1fyl, 2.1 Å

PDB Description: serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head- to-head orientation

PDB Compounds: (A:) heat shock factor protein

SCOPe Domain Sequences for d1fyla_:

Sequence, based on SEQRES records:

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksgsmlsnndsrwefenerha

Sequence, based on observed residues (ATOM records):

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksndsrwefenerha

Timeline for d1fyla_:

• d1fyla_ first appeared in SCOP 1.59
  
• d1fyla_ appears in SCOPe 2.05
  
• d1fyla_ appears in SCOPe 2.07
  
• d1fyla_ appears in the current release, SCOPe 2.08