Lineage for d1fyla_ (1fyl A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1982720Family a.4.5.22: Heat-shock transcription factor [46873] (2 protein domains)
    automatically mapped to Pfam PF00447
  6. 1982721Protein Heat-shock transcription factor [46874] (2 species)
  7. 1982725Species Milk yeast (Kluyveromyces lactis) [TaxId:28985] [46876] (9 PDB entries)
  8. 1982736Domain d1fyla_: 1fyl A: [65068]
    protein/DNA complex

Details for d1fyla_

PDB Entry: 1fyl (more details), 2.1 Å

PDB Description: serendipitous crystal structure containing the heat shock transcription factor's dna binding domain and cognate dna in a head-to-head orientation
PDB Compounds: (A:) heat shock factor protein

SCOPe Domain Sequences for d1fyla_:

Sequence, based on SEQRES records: (download)

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksgsmlsnndsrwefenerha

Sequence, based on observed residues (ATOM records): (download)

>d1fyla_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]}
rpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrqln
mygwhkvqdvksndsrwefenerha

SCOPe Domain Coordinates for d1fyla_:

Click to download the PDB-style file with coordinates for d1fyla_.
(The format of our PDB-style files is described here.)

Timeline for d1fyla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1fylb_