SCOPe 2.06: Domain d1fy1a_: 1fy1 A:

Lineage for d1fy1a_ (1fy1 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Heparin binding protein, HBP [50544] (1 species)
   multifunctional protein (synonym: CAP37, azurocidin)

7. Species Human (Homo sapiens) [TaxId:9606] [50545] (4 PDB entries)

8. Domain d1fy1a_: 1fy1 A: [65065]
   complexed with eoh, nag; mutant

Details for d1fy1a_

PDB Entry: 1fy1, 2.5 Å

PDB Description: [r23s,f25e]hbp, a mutant of human heparin binding protein (cap37)

PDB Compounds: (A:) heparin-binding protein

SCOPe Domain Sequences for d1fy1a_:

Sequence; same for both SEQRES and ATOM records:

>d1fy1a_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]}
ivggrkarprqfpflasiqnqgshecggaliharfvmtaascfqsqnpgvstvvlgaydl
rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplv
ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa

Timeline for d1fy1a_:

• d1fy1a_ first appeared in SCOP 1.59
  
• d1fy1a_ appears in SCOPe 2.05
  
• d1fy1a_ appears in SCOPe 2.07
  
• d1fy1a_ appears in the current release, SCOPe 2.08