SCOP 1.75: Domain d1fxzb1: 1fxz B:10-248

Lineage for d1fxzb1 (1fxz B:10-248)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (24 families)

5. Family b.82.1.2: Germin/Seed storage 7S protein [51187] (4 proteins)

6. Protein Seed storage 7S protein [51188] (6 species)
   duplication: consists of two germin-like domains spatially arranged as subunits in the RmlC dimer; trimer is similar to the germin hexamer

7. Species Soybean (Glycine max), proglycinin [TaxId:3847] [69345] (3 PDB entries)

8. Domain d1fxzb1: 1fxz B:10-248 [65061]

Details for d1fxzb1

PDB Entry: 1fxz, 2.8 Å

PDB Description: crystal structure of soybean proglycinin a1ab1b homotrimer

PDB Compounds: (B:) glycinin g1

SCOP Domain Sequences for d1fxzb1:

Sequence, based on SEQRES records:

>d1fxzb1 b.82.1.2 (B:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfregdliavptgv
awwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeqgghqsqkgk
hqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvkgglsvikp

Sequence, based on observed residues (ATOM records):

>d1fxzb1 b.82.1.2 (B:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]}
necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
ekgaivtvkgglsvikp

Timeline for d1fxzb1:

• d1fxzb1 first appeared in SCOP 1.59
  
• d1fxzb1 appears in SCOP 1.73
  
• d1fxzb1 appears in SCOPe 2.01
  
• d1fxzb1 appears in the current release, SCOPe 2.08