SCOP 1.75: Domain d1fxwf_: 1fxw F:

Lineage for d1fxwf_ (1fxw F:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (9 families)

5. Family c.23.10.3: Acetylhydrolase [52273] (2 proteins)

6. Protein Platelet-activating factor acetylhydrolase [52274] (2 species)

7. Species Cow (Bos taurus), alpha2 [TaxId:9913] [88721] (2 PDB entries)

8. Domain d1fxwf_: 1fxw F: [65058]
   heterodimer with alpha1 subunit
   complexed with ca

Details for d1fxwf_

PDB Entry: 1fxw, 2.1 Å

PDB Description: crystal structure of the recombinant alpha1/alpha2 catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase ib.

PDB Compounds: (F:) platelet-activating factor acetylhydrolase ib beta subunit

SCOP Domain Sequences for d1fxwf_:

Sequence; same for both SEQRES and ATOM records:

>d1fxwf_ c.23.10.3 (F:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha2 [TaxId: 9913]}
snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
ischdmfdflhltgggyakickplhelimqll

Timeline for d1fxwf_:

• d1fxwf_ first appeared in SCOP 1.59
  
• d1fxwf_ appears in SCOP 1.73
  
• d1fxwf_ appears in SCOPe 2.01
  
• d1fxwf_ appears in the current release, SCOPe 2.08