Lineage for d1fxwa_ (1fxw A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578575Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 579135Superfamily c.23.10: SGNH hydrolase [52266] (6 families) (S)
  5. 579148Family c.23.10.3: Acetylhydrolase [52273] (1 protein)
  6. 579149Protein Platelet-activating factor acetylhydrolase [52274] (2 species)
  7. 579150Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries)
  8. 579154Domain d1fxwa_: 1fxw A: [65057]
    heterodimer with alpha2 subunit
    complexed with ca

Details for d1fxwa_

PDB Entry: 1fxw (more details), 2.1 Å

PDB Description: crystal structure of the recombinant alpha1/alpha2 catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase ib.

SCOP Domain Sequences for d1fxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxwa_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrl

SCOP Domain Coordinates for d1fxwa_:

Click to download the PDB-style file with coordinates for d1fxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1fxwa_: