Lineage for d1fxwa_ (1fxw A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120650Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) (S)
  5. 120663Family c.23.10.3: Acetylhydrolase [52273] (1 protein)
  6. 120664Protein Platelet-activating factor acetylhydrolase [52274] (1 species)
  7. 120665Species Cow (Bos taurus) [TaxId:9913] [52275] (6 PDB entries)
  8. 120669Domain d1fxwa_: 1fxw A: [65057]

Details for d1fxwa_

PDB Entry: 1fxw (more details), 2.1 Å

PDB Description: crystal structure of the recombinant alpha1/alpha2 catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase ib.

SCOP Domain Sequences for d1fxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fxwa_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus)}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrl

SCOP Domain Coordinates for d1fxwa_:

Click to download the PDB-style file with coordinates for d1fxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1fxwa_: