SCOP 1.59: Domain d1fxta_: 1fxt A:

Lineage for d1fxta_ (1fxt A:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.20: Ubiquitin conjugating enzyme [54494] (1 superfamily)

4. Superfamily d.20.1: Ubiquitin conjugating enzyme [54495] (1 family)

5. Family d.20.1.1: Ubiquitin conjugating enzyme [54496] (1 protein)

6. Protein Ubiquitin conjugating enzyme [54497] (13 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ubc1 [TaxId:4932] [69685] (2 PDB entries)

8. Domain d1fxta_: 1fxt A: [65055]
   Other proteins in same PDB: d1fxtb_

Details for d1fxta_

PDB Entry: 1fxt

PDB Description: structure of a conjugating enzyme-ubiquitin thiolester complex

SCOP Domain Sequences for d1fxta_:

Sequence; same for both SEQRES and ATOM records:

>d1fxta_ d.20.1.1 (A:) Ubiquitin conjugating enzyme {Baker's yeast (Saccharomyces cerevisiae), ubc1}
srakrimkeiqavkddpaahitlefvsesdihhlkgtflgppgtpyeggkfvvdievpme
ypfkppkmqfdtkvyhpnissvtgaicldilknawspvitlksalislqallqspepndp
qdaevaqhylrdresfnktaalwtrlyas

Timeline for d1fxta_:

• d1fxta_ is new in SCOP 1.59
  
• d1fxta_ appears in SCOP 1.61
  
• d1fxta_ appears in the current release, SCOPe 2.08