SCOP 1.73: Domain d1fuea_: 1fue A:

Lineage for d1fuea_ (1fue A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (8 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
   binds FMN

6. Protein Flavodoxin [52220] (9 species)

7. Species Helicobacter pylori [TaxId:210] [69446] (1 PDB entry)

8. Domain d1fuea_: 1fue A: [65054]
   complexed with fmn

Details for d1fuea_

PDB Entry: 1fue, 2.4 Å

PDB Description: flavodoxin from helicobacter pylori

PDB Compounds: (A:) flavodoxin

SCOP Domain Sequences for d1fuea_:

Sequence; same for both SEQRES and ATOM records:

>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]}
gkigiffgtdsgnaeaiaekiskaignaevvdvakaskeqfngftkvilvaptagagdlq
tdwedflgtleasdfanktiglvglgdqdtysetfaegifhiyekakagkvvgqtstdgy
hfaaskaveggkfvglvidednqddltderiakwveqvrgsfa

Timeline for d1fuea_:

• d1fuea_ first appeared in SCOP 1.59
  
• d1fuea_ appears in SCOP 1.71
  
• d1fuea_ appears in SCOP 1.75
  
• d1fuea_ appears in the current release, SCOPe 2.08