Lineage for d1ft4b2 (1ft4 B:72-115)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. Protein Tumor necrosis factor (TNF) receptor, middle domain [419066] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419557] (4 PDB entries)
  8. 3034743Domain d1ft4b2: 1ft4 B:72-115 [65052]
    Other proteins in same PDB: d1ft4a1, d1ft4a3, d1ft4a4, d1ft4b1, d1ft4b3
    complexed with 703

Details for d1ft4b2

PDB Entry: 1ft4 (more details), 2.9 Å

PDB Description: photochemically-enhanced binding of small molecules to the tumor necrosis factor receptor-1
PDB Compounds: (B:) soluble tumor necrosis factor receptor 1

SCOPe Domain Sequences for d1ft4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft4b2 g.24.1.1 (B:72-115) Tumor necrosis factor (TNF) receptor, middle domain {Human (Homo sapiens) [TaxId: 9606]}
scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf

SCOPe Domain Coordinates for d1ft4b2:

Click to download the PDB-style file with coordinates for d1ft4b2.
(The format of our PDB-style files is described here.)

Timeline for d1ft4b2: