Lineage for d1ft4a2 (1ft4 A:72-115)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639372Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2639373Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2639374Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2639439Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 2639440Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 2639457Domain d1ft4a2: 1ft4 A:72-115 [65049]
    Other proteins in same PDB: d1ft4a4
    complexed with 703

Details for d1ft4a2

PDB Entry: 1ft4 (more details), 2.9 Å

PDB Description: photochemically-enhanced binding of small molecules to the tumor necrosis factor receptor-1
PDB Compounds: (A:) soluble tumor necrosis factor receptor 1

SCOPe Domain Sequences for d1ft4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft4a2 g.24.1.1 (A:72-115) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
scskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqcf

SCOPe Domain Coordinates for d1ft4a2:

Click to download the PDB-style file with coordinates for d1ft4a2.
(The format of our PDB-style files is described here.)

Timeline for d1ft4a2: