Lineage for d1ft4a1 (1ft4 A:12-71)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261362Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 2261363Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 2261364Family g.24.1.1: TNF receptor-like [57587] (6 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. 2261429Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 2261430Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 2261446Domain d1ft4a1: 1ft4 A:12-71 [65048]
    Other proteins in same PDB: d1ft4a4
    complexed with 703

Details for d1ft4a1

PDB Entry: 1ft4 (more details), 2.9 Å

PDB Description: photochemically-enhanced binding of small molecules to the tumor necrosis factor receptor-1
PDB Compounds: (A:) soluble tumor necrosis factor receptor 1

SCOPe Domain Sequences for d1ft4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ft4a1 g.24.1.1 (A:12-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens) [TaxId: 9606]}
dsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl

SCOPe Domain Coordinates for d1ft4a1:

Click to download the PDB-style file with coordinates for d1ft4a1.
(The format of our PDB-style files is described here.)

Timeline for d1ft4a1: