Lineage for d1fsfa_ (1fsf A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily) Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) 
Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein) Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species) Species Escherichia coli [TaxId:562] [52515] (10 PDB entries) 
Domain d1fsfa_: 1fsf A: [65047]
Details for d1fsfa_
PDB Entry: 1fsf (more details), 1.9 Å
PDB Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 1.9a resolution
SCOP Domain Sequences for d1fsfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fsfa_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl
SCOP Domain Coordinates for d1fsfa_:
Click to download the PDB-style file with coordinates for d1fsfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fsfa_:
- d1fsfa_ is new in SCOP 1.59
- d1fsfa_ appears in SCOP 1.61
- d1fsfa_ appears in the current release, SCOPe 2.08
View in 3D