Lineage for d1fs6a_ (1fs6 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713168Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 713169Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (7 families) (S)
  5. 713170Family c.124.1.1: NagB-like [52513] (2 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 713175Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)
  7. 713176Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 713192Domain d1fs6a_: 1fs6 A: [65046]

Details for d1fs6a_

PDB Entry: 1fs6 (more details), 2.2 Å

PDB Description: glucosamine-6-phosphate deaminase from e.coli, t conformer, at 2.2a resolution
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOP Domain Sequences for d1fs6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fs6a_ c.124.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase NagB {Escherichia coli [TaxId: 562]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1fs6a_:

Click to download the PDB-style file with coordinates for d1fs6a_.
(The format of our PDB-style files is described here.)

Timeline for d1fs6a_: